Me
I started game making and programming at age 13, around the year 2006.
I first used GameMaker with which I made a game where you had to capture a bunch of ghosts that were bouncing around the screen (one classmate liked it).
That was followed by learning to code by making MODs and development tools for the games Dink Smallwood and Gothic. I'm still into retro games btw. Those two weren't that retro back then, though.
At first I used Visual Basic (6.0 to be precise, then upgraded myself to VB .NET with VS Express 2005).
Eventually I found out about this cool thing called C#, which quickly became my main language. My favorite languages now are C++ and C#.
Over the years I worked on various types of software, ranging from mobile and web apps, both back- and front-end, to desktop tools and games. Past employers include companies such as Gameloft and Yardi Systems.
Contact
If your project needs a freelance programmer with a broad skillset, who can adapt to a new project quickly with minimal onboarding, shoot me an email at zbqyqpoyvqgpydyqppanyalyqyvepqxyqyqmayqrgpyqiyqnywqyepyqyqyayvfqpyqwyqn example com and let's discuss.
Or find me on bsky.
My (Personal) Projects
Current
DuskEngine
A cross-platform 3D game engine written in C++ with which I'm working towards building a game.
It's been in development for around four years now.
It uses Lua for scripting and is based on an ECS architecture internally. Systems are designed to be easily replaced if a project has specific needs. It currently has OpenGL and Metal renderers and runs on Windows, Linux and MacOS. Web support is planned for the near future.
I write about it a lot on my blog.
Old
PQ3D
Made with Unity.
Focused on managing a small band of heroes through a sequence of story based missions, with goals such as defeating a particular enemy in a dungeon. The heroes would gather their own food, craft their own items, and it was up to you to provide them with the means to do so and to offer them the guidance needed for attaining the true goal of the mission.
Some of the gameplay features were similar to what you'd see in the Majesty series.
I released a prototype build at one point, but the project kinda fizzled out afterward.
Ancient
Ars Ignis
My first Unity project, from way back in high school. It was meant to be a first person RPG taking place in an underground world, much of it inspired by games such as Arx Fatalis and Ultima Underworld.
The scale of it was too grand for my resources at the time, so it was postponed indefinitely. I still feel the call to make such a game, from time to time...
An Aeophian Adventure: Dink goes to Aeophia
A Dink Smallwood MOD I made in my teen years. It featured a TON of trees.
It can still be found here.










